LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); }, "displaySubject" : "true", return false; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, { "disallowZeroCount" : "false", // If watching, pay attention to key presses, looking for right sequence. }, } return false; }, { "useTruncatedSubject" : "true", "action" : "rerender" } "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); ] "event" : "ProductMessageEdit", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:feedbackData", }, LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "event" : "kudoEntity", { "context" : "envParam:quiltName,product,contextId,contextUrl", } }, }, { }, "actions" : [ "context" : "envParam:quiltName", ;(function($) { ] o.innerHTML = "Page number must be 1 or greater. ] "action" : "rerender" { } "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetMessageEdit", { { ] if (val.trim() == "") "initiatorBinding" : true, "action" : "rerender" ] { "actions" : [ ] "context" : "", "context" : "", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'ayI8EgVVuLDIm4e-SBUwJoMDIKydV7hOavJi0ht5lTc. "context" : "", { }, { "; "actions" : [ "actions" : [ ] { if ( key == neededkeys[0] ) { "event" : "kudoEntity", { }, "event" : "unapproveMessage", "truncateBody" : "true", })(LITHIUM.jQuery); // Pull in global jQuery reference "event" : "approveMessage", "triggerEvent" : "click", "action" : "rerender" ] } } ] { "actions" : [ ;(function($) { } } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); '; { "context" : "envParam:feedbackData", }, "context" : "", "truncateBodyRetainsHtml" : "false", "action" : "rerender" "action" : "pulsate" "disableLabelLinks" : "false", }, "context" : "", }, }, "context" : "envParam:feedbackData", } // Reset the conditions so that someone can do it all again. LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" { "action" : "rerender" { Multimedia message port: }, ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); element.find('li').removeClass('active'); "actions" : [ "showCountOnly" : "false", "action" : "rerender" } "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", Private Daten erfragen wir bei Bedarf. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "event" : "deleteMessage", "context" : "envParam:quiltName", }, }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1934530,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { ] { "action" : "rerender" "context" : "envParam:selectedMessage", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "actions" : [ LAUFBASIS ®-Einlagenkonzept; Einlagenversorgung bei Sicherheitsschuhen { "action" : "rerender" "context" : "envParam:feedbackData", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "eventActions" : [ }, "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "QuickReply", "context" : "envParam:quiltName", { return false; "selector" : "#kudosButtonV2_7", "linkDisabled" : "false" "parameters" : { }, { } "event" : "ProductAnswer", ] "event" : "MessagesWidgetAnswerForm", "context" : "envParam:quiltName,expandedQuiltName", } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "action" : "rerender" setWarning(pagerId); ] "context" : "", window.location = "https://forum.vodafone.de/t5/LTE/LTE-%C3%96ffentliche-IP/td-p/1902762" + "/page/" + val; } "eventActions" : [ "action" : "rerender" "actions" : [ "action" : "rerender" "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "truncateBodyRetainsHtml" : "false", "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, { ] ] Password: "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" { } "event" : "expandMessage", "event" : "addThreadUserEmailSubscription", "event" : "MessagesWidgetMessageEdit", { "actions" : [ ], "parameters" : { }, }, "action" : "rerender" "actions" : [ clearWarning(pagerId); } { "context" : "", clearWarning(pagerId); { } "action" : "rerender" "action" : "rerender" }, } { }, }); In Cellular, select your SIM card Select Properties Under MMS APN select Add an MMS APN. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "context" : "", "componentId" : "kudos.widget.button", }); function doChecks(pagerId, val) { { if (1 != val) { } "parameters" : { "actions" : [ "action" : "pulsate" } }, { { ] "context" : "", { "action" : "rerender" { ] "initiatorBinding" : true, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); if (doChecks(pagerId, val)) "actions" : [ return false; "; "actions" : [ } ], ], LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'F1G-ynkbJkOvTJmJqtyMvsdPt5bl7m8BAXki_nddhIs. } "event" : "QuickReply", "context" : "", }, } { { "event" : "kudoEntity", Bearer: Unspecified. "context" : "envParam:quiltName", "actions" : [ "actions" : [ ] ] "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "eventActions" : [ var count = 0; "event" : "markAsSpamWithoutRedirect", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1933261 .lia-rating-control-passive', '#form_5'); }, "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetEditAnswerForm", }); ] ] "event" : "MessagesWidgetAnswerForm", o.innerHTML = ""; } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "event" : "QuickReply", } } "action" : "rerender" "context" : "", "actions" : [ Ich möchte eine IP Kamera an einen Teltonika Router mit Dyndns betreiben. ] { "event" : "QuickReply", "actions" : [ "quiltName" : "ForumMessage", "truncateBody" : "true", }, { LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "eventActions" : [ } }, "action" : "rerender" { LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "useSubjectIcons" : "true", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "action" : "rerender" "message" : "2037061", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); { "initiatorDataMatcher" : "data-lia-kudos-id" { { "event" : "MessagesWidgetAnswerForm", MMSC port: "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", ] $(this).next().toggle(); IP type: IPv4. "message" : "1903490", "actions" : [ "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", } "action" : "rerender" "actions" : [ } { count++; ] "defaultAriaLabel" : "", "selector" : "#messageview_7", "event" : "markAsSpamWithoutRedirect", }, "action" : "pulsate" } "actions" : [ }, "selector" : "#messageview_2", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2036304,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" }, ] ] }); { "event" : "approveMessage", "useTruncatedSubject" : "true", if ( key == neededkeys[0] ) { { } "action" : "pulsate" { if (isNaN(val) ) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); Bist du sicher, dass du fortfahren möchtest? "componentId" : "forums.widget.message-view", { { }, "kudosable" : "true", { // just for convenience, you need a login anyways... "context" : "lia-deleted-state", ;(function($) { "context" : "lia-deleted-state", "event" : "ProductAnswerComment", "event" : "MessagesWidgetEditCommentForm", }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_7dd2fb50dc640_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/123456789/thread-id/4098&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ], { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "ProductAnswerComment", .attr('aria-hidden','true') ] { ] "event" : "addMessageUserEmailSubscription", { { ] ] }, }, { }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456789/thread-id/4098","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cvZqIkXZP5f7jSq6l6ldeBLKTSN5fFlJ9ivHQjhE6KY. LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "addMessageUserEmailSubscription", "message" : "2036304", ] // We're good so far. }, "context" : "envParam:feedbackData", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); { return false; "actions" : [ { "context" : "", } }); setWarning(pagerId); "action" : "rerender" } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.Loader.runJsAttached(); }, Password: "disallowZeroCount" : "false", ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "event" : "approveMessage", "actions" : [ ] "disableKudosForAnonUser" : "false", "componentId" : "forums.widget.message-view", { "action" : "rerender" }, "context" : "envParam:feedbackData", "parameters" : { "event" : "MessagesWidgetAnswerForm", }, }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "kudoEntity", "context" : "", }, { { ] "context" : "", ] { } "entity" : "1905112", { "context" : "envParam:feedbackData", } { LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "truncateBody" : "true", "displaySubject" : "true", "event" : "ProductMessageEdit", }, ] { ] "selector" : "#kudosButtonV2_7", } "revokeMode" : "true", { return false; }); "componentId" : "kudos.widget.button", { "action" : "rerender" "disallowZeroCount" : "false", }, "linkDisabled" : "false" }, "context" : "", "disableLabelLinks" : "false", "context" : "", "truncateBody" : "true", "event" : "removeThreadUserEmailSubscription", }, "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" } "context" : "", element.removeClass('active'); $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, var resetMenu = function() { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }); { "truncateBodyRetainsHtml" : "false", APN protocol: IPv4/IPv6 LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.ComponentEvents.set({ "showCountOnly" : "false", { "context" : "envParam:entity", "actions" : [ } "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName", "event" : "MessagesWidgetEditAction", { "}); Danach können Sie die bisherigen IP- Adressen nicht mehr nutzen. "selector" : "#messageview_3", { Authentication type: None { "; "context" : "envParam:feedbackData", "event" : "MessagesWidgetMessageEdit", { }, } }, "event" : "RevokeSolutionAction", "context" : "", } } "event" : "MessagesWidgetMessageEdit", { { LITHIUM.Dialog.options['-90348906'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disableKudosForAnonUser" : "false", "actions" : [ ] o.innerHTML = "Page must be in a numeric format. }); "showCountOnly" : "false", "action" : "rerender" }, "forceSearchRequestParameterForBlurbBuilder" : "false", } "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "actions" : [ } "quiltName" : "ForumMessage", ] }, "action" : "rerender" }, "actions" : [ "event" : "ProductAnswer", "disallowZeroCount" : "false", "action" : "rerender" "quiltName" : "ForumMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { { function disableInput(pagerId) { "event" : "removeThreadUserEmailSubscription", clearWarning(pagerId); "context" : "", }, "context" : "", "event" : "ProductAnswerComment", "context" : "", ] }, { "action" : "addClassName" })(LITHIUM.jQuery); } { { ] "event" : "MessagesWidgetEditCommentForm", { watching = false; { { "eventActions" : [ { "context" : "", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_7dd2fb50dc640","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/123456789/thread-id/4098&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, $(event.data.selector).addClass('cssmenu-open') "actions" : [ }, "action" : "rerender" "action" : "addClassName" .attr('aria-selected','true'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); element.siblings('li').find('li').removeClass('active'); "action" : "rerender" ] "event" : "MessagesWidgetEditAction", "initiatorBinding" : true, { { "truncateBodyRetainsHtml" : "false", "event" : "ProductAnswer", LITHIUM.AjaxSupport.ComponentEvents.set({ } "context" : "envParam:quiltName", ], "event" : "removeThreadUserEmailSubscription", "context" : "", { "linkDisabled" : "false" "event" : "MessagesWidgetCommentForm", "action" : "pulsate" { "actions" : [ "event" : "MessagesWidgetCommentForm", "action" : "rerender" } { { window.location.replace('/t5/user/userloginpage'); "entity" : "1902988", }, "context" : "envParam:quiltName,product,contextId,contextUrl", } } }, "context" : "", "componentId" : "kudos.widget.button", { "context" : "envParam:quiltName", "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "disableLabelLinks" : "false", }, "disableLabelLinks" : "false", }, { "actions" : [ { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/123456789/thread-id/4098","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OYYnrMSsyt6J082_5IgIz1BqIxqEMGaQAa6_b71NtMY. LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ } "action" : "rerender" "useSubjectIcons" : "true", "actions" : [ "event" : "ProductAnswerComment", "context" : "", } { "context" : "envParam:quiltName,message", }, "actions" : [ ] }, { "event" : "kudoEntity", } { "actions" : [ "showCountOnly" : "false", ] } { "showCountOnly" : "false", "actions" : [ } { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); ] "event" : "MessagesWidgetEditAction", } }); "event" : "QuickReply", { { "kudosable" : "true", { "event" : "editProductMessage", "action" : "rerender" } ] ] "showCountOnly" : "false", { "event" : "MessagesWidgetAnswerForm", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); // If watching, pay attention to key presses, looking for right sequence. { "actions" : [ { "event" : "addThreadUserEmailSubscription", ], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1905112 .lia-rating-control-passive', '#form_2');